PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009600694.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 386aa    MW: 43785 Da    PI: 6.1718
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009600694.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.93.3e-52141411128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     + pGfrFhPtdeelv +yLk+k+++++l++ e ik+vdiyk++PwdLp+ ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s+
  XP_009600694.1  14 MLPGFRFHPTDEELVGFYLKRKIQQRSLPI-ELIKQVDIYKYDPWDLPRLASTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSS 107
                     579***************************.89***************8888899***************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +glkk+Lvfy+gra +g ktdW+mhe+rl
  XP_009600694.1 108 dSTKCIGLKKSLVFYRGRAARGIKTDWMMHEFRL 141
                     55666***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-5812173IPR003441NAC domain
PROSITE profilePS5100556.70414173IPR003441NAC domain
PfamPF023651.4E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MDNKSDVEKL DEAMLPGFRF HPTDEELVGF YLKRKIQQRS LPIELIKQVD IYKYDPWDLP  60
RLASTGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPIYSSDST KCIGLKKSLV  120
FYRGRAARGI KTDWMMHEFR LPTTTIDSAP PRKFLDKNFP PNDSWAICRI FKKTNSIANR  180
ALSYPWINPL SDVASPEVFN QSTTVHFSAE NISSLTETGS LLHLSSTNDL LQGASNVPSY  240
KTLNTMVSRP SFLSSPSTEV PCNFMFSSPE VSMFFNTPPA LKNADIKTSE TIDFEGSNQQ  300
MNSFSISSSQ EMQRSIGMED DEAGLRSNQD STNDNTTQWE NIRSIGFPFS LTTSLADEWK  360
PSLSWDSPSC PSEISTTYDS TNKCYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-531617617171Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1225442e-84AC122544.1 Genomic sequence for Lycopersicon esculentum, clone L136C6, complete sequence.
GenBankAC2265072e-84AC226507.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0136C06, complete sequence.
GenBankEU1612832e-84EU161283.1 Solanum lycopersicum clone BAC L136C6 transcription factor style2.1 gene, complete cds.
GenBankHG9754412e-84HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755142e-84HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600694.10.0PREDICTED: putative NAC domain-containing protein 94
SwissprotQ9ZVH01e-101FEZ_ARATH; Protein FEZ
TrEMBLM0ZLH20.0M0ZLH2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000033430.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22022262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-103NAC family protein